PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g01820.7.p
Common NameBRADI_4g01820, LOC100844028
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NF-YA
Protein Properties Length: 212aa    MW: 22930.3 Da    PI: 7.8704
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g01820.7.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.21.1e-32105161158
         CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                       +ep+YVNaKQy++Il+RRq+Rak+e+e+kl +k+rkpylheSRh+hAl+R+Rg gGrF
  Bradi4g01820.7.p 105 EEPVYVNAKQYNAILRRRQSRAKAESERKL-IKGRKPYLHESRHQHALKRARGAGGRF 161
                       69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.3E-35103164IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.934104164IPR001289Nuclear transcription factor Y subunit A
PfamPF020458.1E-27106161IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.0E-23107129IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860109129IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.0E-23138161IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MTSVADGISG DHRADEQQQQ QTQAGHEDQQ EAPATSIGSQ TMVVAPSTDY VMPYAHQEVC  60
HAMGQIAYPS IDPYFYGAYG GQPMMHPPLV GMHPAGLPLP TDAIEEPVYV NAKQYNAILR  120
RRQSRAKAES ERKLIKGRKP YLHESRHQHA LKRARGAGGR FLNAKSDDNE EHSDSSSKDK  180
QNGVAPRSSG QPSTAPSSKG ASPANQTGNR E*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A5e-22104177174NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3639341e-155AK363934.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2020D05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014758866.11e-156PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
RefseqXP_010237028.11e-156PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
RefseqXP_010237027.11e-156PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
SwissprotQ84JP13e-43NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
TrEMBLI1IGH11e-156I1IGH1_BRADI; Uncharacterized protein
STRINGBRADI4G01820.11e-155(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.13e-39nuclear factor Y, subunit A7